NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214168_1059002

Scaffold Ga0214168_1059002


Overview

Basic Information
Taxon OID3300021140 Open in IMG/M
Scaffold IDGa0214168_1059002 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)889
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, WI
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000403Metagenome / Metatranscriptome1177Y
F050366Metagenome / Metatranscriptome145Y
F086582Metagenome / Metatranscriptome110N

Sequences

Protein IDFamilyRBSSequence
Ga0214168_10590021F086582N/AMIDRIEEVQCMIAAISHCHDRSADHSSRIVKNLSWFEYVAQMAESMLAEMVVAKRLGYDYQPGITWDKSK
Ga0214168_10590022F000403GGTGGLDVGKMSDYIEIIHPQSMTAKLLCNGVVVEEYKIEQCDKCSQLRRLDQFGYQKGYDRTENIIWFCGDCR
Ga0214168_10590023F050366N/AYSEKMRRWMVEDTCTSALMRVMALVMGGTEKATQEVMAQVNGKSPKAMDYDYWATKFGDVPSYQTREEAEEVKETAWTAETVPGCSHGSMRWNQSKPDAPKPWAGYFCSEKIKEKQCKPLWYVLTSDGTFKPQV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.