NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0179596_10205999

Scaffold Ga0179596_10205999


Overview

Basic Information
Taxon OID3300021086 Open in IMG/M
Scaffold IDGa0179596_10205999 Open in IMG/M
Source Dataset NameVadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)959
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)39.7291Long. (o)-123.6419Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007852Metagenome / Metatranscriptome343Y
F020674Metagenome / Metatranscriptome222Y

Sequences

Protein IDFamilyRBSSequence
Ga0179596_102059991F007852GGAGMKPSAICRLLSAVLLIGAAPAAAQTSLSIYRDGRVVVRRTLPQALQQGRNALTLRLEALDPATLFSTDTSVSVVTATVRYPSAKNDALARATGQTLSFVRSVGDTVKATIVRVDPPQYRLPDGRLLLEQPGEPLFPAELVRTGPEAQVVLDAARGRPRTDIAYVAQGITWEALYQVILTGARAQVTGTATVSSQALRADSADIQLVAGAIQRTRNKSGNFA
Ga0179596_102059992F020674N/APAPWLSGLGPSHPCAKCGVDTAGIAIGGLCRDCTRLLERRAAKTARLVAIGTTAPLAVYVALALPVERTARLVGAASVLLWYVLTFLIAKRVTLEFLK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.