NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214253_102356

Scaffold Ga0214253_102356


Overview

Basic Information
Taxon OID3300020681 Open in IMG/M
Scaffold IDGa0214253_102356 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Trout Bog Lake, WI - 21JUL2009 hypolimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)2619
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (42.86%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameTrout Bog, Vilas County, Wisconsin, USA
CoordinatesLat. (o)46.041Long. (o)-89.686Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008745Metagenome / Metatranscriptome328N
F028153Metagenome / Metatranscriptome192N
F032254Metagenome / Metatranscriptome180N

Sequences

Protein IDFamilyRBSSequence
Ga0214253_1023562F032254N/AMCVRKVGYRVAEKRFVAIPRLPPPSDKDAMSKFVVDTLCSNRACRYRQDVPMVQSLAQCTRSCGNPSCFYQSCHVVLVLDPSPKLFRDVLDVYKG
Ga0214253_1023565F008745GGAMSNGYQITEEERDTLVCPRLECMGAQELLDVWLLPLVQEVGGILEEAYRTSHQLFERGQGEERLLGHLQHKLMTAIDELEVVQGWIASSCNMSSDKECRVLDGEEDKSEGKVLKEGSEANQSADQQADCGKQKSTSYYQWKLRHE
Ga0214253_1023567F028153N/ANCEITEEELCFVRRLVNRRSFPTTKRLDDWLRIMEEVVKVLGILYRSSFRLLESNNFKDESILDLLRTVYISAMAEVDVVKGERT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.