NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214169_107024

Scaffold Ga0214169_107024


Overview

Basic Information
Taxon OID3300020677 Open in IMG/M
Scaffold IDGa0214169_107024 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Trout Bog Lake, WI - 13JUN2007 epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)685
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameTrout Bog, Vilas County, Wisconsin, USA
CoordinatesLat. (o)46.041Long. (o)-89.686Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037570Metagenome / Metatranscriptome167N
F057095Metagenome / Metatranscriptome136N

Sequences

Protein IDFamilyRBSSequence
Ga0214169_1070241F057095N/ASQYILVHYFKIDDLIKKESYPLQEVITFHNKKCRIQKSKDIVTLEKVAIANKLLIKTLSEEIRNALKEQLALVSKVGSTFTNLSLMYTYIENNDSGLQLEAKSRQWSNEYQET
Ga0214169_1070242F037570AGTAGMNIKKLDLLKIRNLKFRASQRQSVIDRLLRKKDLEKDLWKVSIKTLIILAKIKFRCEELERISENLEQTVINGY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.