NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208221_1006375

Scaffold Ga0208221_1006375


Overview

Basic Information
Taxon OID3300020574 Open in IMG/M
Scaffold IDGa0208221_1006375 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 26JUN2009 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2247
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008943Metagenome / Metatranscriptome325Y
F014121Metagenome / Metatranscriptome265Y
F024768Metagenome / Metatranscriptome204Y

Sequences

Protein IDFamilyRBSSequence
Ga0208221_10063751F008943GGAGGMKNFDEITWAVLSFFFIIIVAGAIITYDAQQRRVLFQQTYNKNLECRQALKDQTMVRVNEICGTVPVIGDFVK
Ga0208221_10063752F014121N/AMTNTAYQIWETFKAELIVEPTEDMKEALASSIRVISSIIHRDGVLENEPWHLHIAQELNEISYDVEAL
Ga0208221_10063753F024768GAGMNYETEIIDGHKAVVRHFFKPHEIQVGSRWARADGSKGYVTVEGFNSYGDTDPWHEVVYSWEENGVKKIWQKENFIFQCRYCLIVE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.