NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208485_1004595

Scaffold Ga0208485_1004595


Overview

Basic Information
Taxon OID3300020573 Open in IMG/M
Scaffold IDGa0208485_1004595 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 17JUL2012 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3479
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (76.92%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002357Metagenome / Metatranscriptome567Y
F024063Metagenome207N
F037698Metagenome / Metatranscriptome167Y

Sequences

Protein IDFamilyRBSSequence
Ga0208485_100459511F024063GAGMTLELAIYLFIGLSFAYWALLVRIDDLKQTHYWRGRKDGWDMHRRMINIKQQSDEVFDYDKN
Ga0208485_10045954F037698AGGAGMCDSHDEGTHQIDWAYQNELRKQWLIDNPDSQYIGWMSI
Ga0208485_10045959F002357GGAGGMAFKLDDYEDVATLNKWFISNYPMGRSDLSVINHDPEKGYILIQATIWRDSKDAFPAVSNVAFGSRETYIPNMKKFYVEDTATSALGRAIILLKGSDKTATRDDMQKVESNPSFKEKLESRQNMYGKAGSKSAQIETILRDSFAADKKEPEPVAWSVGDVVDQIGSSIPNEPPSCQHGHILKEGISKGGKPYYGYVCKAKECPPNWATLTANGKWYFKGGE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.