NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208231_1028237

Scaffold Ga0208231_1028237


Overview

Basic Information
Taxon OID3300020557 Open in IMG/M
Scaffold IDGa0208231_1028237 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 15JUN2012 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)940
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F086607Metagenome / Metatranscriptome110Y
F092953Metagenome / Metatranscriptome107N

Sequences

Protein IDFamilyRBSSequence
Ga0208231_10282371F086607AGAAGGMTVIQAIELNIYTMRTLRSDESAKYIALVRTSDRIPDPSVRDTDGDDLRSAEIHTDDFDDFFMSIPKDDFSD
Ga0208231_10282372F092953N/AKKVKVTWHVAKNEDQPVSRFQIPLVPPGLSSTIHVAQGTEMFPIIKLDETITPTHVFVAMTRSRRSSRCLIEPSDNFDFGVFGKGTPLNPKNELLLAHLRGDDDFEEQLVEYHSRAKATKPKADPKSISSSRTLAGQSGDRKRKREGGENGDHQRKGGDRMQQQAAGREGGRAGDVEDKRKAGRAGDVDVQRAAKKIERAHSKCCRPPTPRSRRRCHHRCNDQYL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.