Basic Information | |
---|---|
Taxon OID | 3300020538 Open in IMG/M |
Scaffold ID | Ga0208595_1001884 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Lake Mendota, WI - 28JUN2011 deep hole epilimnion (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 6183 |
Total Scaffold Genes | 16 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 14 (87.50%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lake Mendota, Madison, Wisconsin, USA | |||||||
Coordinates | Lat. (o) | 43.098333 | Long. (o) | -89.405278 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F004477 | Metagenome / Metatranscriptome | 436 | Y |
F022885 | Metagenome / Metatranscriptome | 212 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0208595_100188413 | F004477 | AGAAG | MSLMSFFSSPPITSFEQLELEKGKIQLTIMKMAAAVLGSIMMAVVAIFLVGLFMPNHVIDNNEIFKIIGPAFSTIVGAFVGAFATMMGMKVTELDTNVKTQELGKTDHKQLAEAHVINAQAETIETENEIKMMAAIDKYKDSDEDFGPF |
Ga0208595_10018847 | F022885 | AGGA | MTDLVDNEFGIEYEQISIKKLRIFRVGKQWLVEYQRYVRLWAPWDHFWWYNDGQYVEYYDALARVNDLKASGYANVPRFMNVKTFEVEQ |
⦗Top⦘ |