NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208697_1000075

Scaffold Ga0208697_1000075


Overview

Basic Information
Taxon OID3300020507 Open in IMG/M
Scaffold IDGa0208697_1000075 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 12SEP2008 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)16185
Total Scaffold Genes49 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)37 (75.51%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.099444Long. (o)-89.404444Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000325Metagenome / Metatranscriptome1296Y
F008812Metagenome / Metatranscriptome327Y
F059898Metagenome / Metatranscriptome133Y

Sequences

Protein IDFamilyRBSSequence
Ga0208697_100007521F059898AGGAMNKEREKAMVYILSFFRSKMAAMNKHNVSQVKEYISTHEIAVSELVDMYVRLVYENS
Ga0208697_100007529F000325AGGAGMKTADGNDKLGKGCIVVSRPVGDTCPPDCDYLNNGCYAEATENQYKNARVAGFANIVTEKNKIRAMILDAKKRKKSIRWHERGDWFLNGELDLDYLANVTWACESILADGDSLPDMWFYTHIYDDRLVSLEKYMNVYASVHDDKDMGEAMAQGFKLFAWCDSDMKIAPKRPKSKVKAEAWRKALPKLVVLNGAKFVTCPEIRRGRSVITCTGTKDSISCDMCVKGLANVLFPAH
Ga0208697_100007531F008812AGGAGGMIQWVGILLTVAGLIYTGVKDYQKGDIKIPTVQKHLTPVKYPIQYCLMAYDPNLDKVFYLHENGLWYDYAPEQRRYAASPQVRDGQGEGQGPVGSGYGPPRTPRYAYGQSPQASAYPSRY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.