NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208591_1010199

Scaffold Ga0208591_1010199


Overview

Basic Information
Taxon OID3300020493 Open in IMG/M
Scaffold IDGa0208591_1010199 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 14NOV2009 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1348
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (100.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000311Metagenome / Metatranscriptome1326Y
F013892Metagenome / Metatranscriptome267Y
F047650Metagenome / Metatranscriptome149Y
F071228Metagenome / Metatranscriptome122N

Sequences

Protein IDFamilyRBSSequence
Ga0208591_10101991F071228AGGAMETPYGATVTPAVPATYNPSALVQYKVIQGEDVTYPISKVTDLEWDLQQGRTNRESLDALKSTVRELEELLIELYNPNYTKEEALQQIAELFGFELSKTVTVTGTINFEVIMQVPLDEVEDFDAHYKLGDELSLTSYNGDIEINDWSIESTDVDWD
Ga0208591_10101992F000311GGAMYFELTAPDRLSMEMAYWDAQIIGLDPTAMSPLTFNVGTGSIEKVSKIRDKYNLTESYTSDYEPTGYTRR
Ga0208591_10101994F047650GGAMAEDVSPVYYCDSCSVARASYLIKLLDGELAFCTHHYNKSKKALDEKAYEVIELNKKEDLPKIKEMAE
Ga0208591_10101995F013892GGCGGMGDRANFGFVQPNGQTIVLYGHWAGHQMLGKLADAVIAARPRWNDSSYATRIAISNIIADQWNMETGWGLYVNEIGDNEHKIAII
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.