Basic Information | |
---|---|
Taxon OID | 3300020442 Open in IMG/M |
Scaffold ID | Ga0211559_10058948 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | CEA Genoscope |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1879 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | TARA_140 | |||||||
Coordinates | Lat. (o) | 7.416 | Long. (o) | 79.3102 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F092194 | Metagenome | 107 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0211559_100589482 | F092194 | N/A | MTGKLKVLSLSKEIEGLKAKKNYTDVNIHFRNLHHHTMTLKNKKEYVLEITATSIEADSLMIEGDVWANGEEEWRAGTIFEFRFYPTAK |
⦗Top⦘ |