| Basic Information | |
|---|---|
| Taxon OID | 3300020438 Open in IMG/M |
| Scaffold ID | Ga0211576_10001115 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CEA Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 21011 |
| Total Scaffold Genes | 33 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 18 (54.55%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | TARA_133 | |||||||
| Coordinates | Lat. (o) | 35.4118 | Long. (o) | -127.7122 | Alt. (m) | Depth (m) | 45 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002902 | Metagenome / Metatranscriptome | 522 | Y |
| F059878 | Metagenome | 133 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0211576_1000111516 | F002902 | GGAGG | MAGITSTKAAKASNGLGPRTRIINLAKTNITQDELDAALRYLAAGDVAGTNDAHTVAGVSCLTESGVFTAGTTDNVQIVIQGTGAFTAASDFGIGSTGVTSSLLADIL |
| Ga0211576_1000111528 | F059878 | N/A | MNQGVDMYKEKARKKKDVNPFMIKKGFYITEMNMGHVPGDGYELISTSDVAGPFKTLDRARKIFKKIVCEVDYRNHWDFGIVGPKHRPSGYETPWYSFKERENY |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |