| Basic Information | |
|---|---|
| Taxon OID | 3300020391 Open in IMG/M |
| Scaffold ID | Ga0211675_10063013 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100000989 (ERX556130-ERR598967) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CEA Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1759 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | TARA_096 | |||||||
| Coordinates | Lat. (o) | -29.6749 | Long. (o) | -101.2137 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005433 | Metagenome / Metatranscriptome | 401 | Y |
| F022758 | Metagenome / Metatranscriptome | 213 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0211675_100630132 | F022758 | AGGAG | MSTLPATGSNISMSTVRNYFGLSGTVSLSQLGSHISPSVTSNIRLSATFGGWQYPSPSGAHP |
| Ga0211675_100630133 | F005433 | AGGAG | MIRTRYEIETFVLGAHPSPARKAQVLTQELMKARETSHPDLPVLEEIYKDFTAEHNVEELTKDIESTEEEYWVHRLAKLAAIDILTIGKVQPEHMAYMVALPDEAFKASVKEATSIAKQLNYEVQQIEAELQADLASAK |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |