| Basic Information | |
|---|---|
| Taxon OID | 3300020372 Open in IMG/M |
| Scaffold ID | Ga0211683_10043686 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100000787 (ERX556133-ERR599090) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CEA Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1486 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | TARA_085 | |||||||
| Coordinates | Lat. (o) | -62.1363 | Long. (o) | -49.3331 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004990 | Metagenome | 416 | Y |
| F008915 | Metagenome / Metatranscriptome | 326 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0211683_100436863 | F004990 | GGA | MYGDPKKPCCVCKRGADLNEKGKRYCADHYALHILGKSMSQIEKELGVKK |
| Ga0211683_100436864 | F008915 | N/A | DLIAILVCITKIGLSMFIGAKIKRVTMSDNITLDLYELHSASHLGILRCLESIKNKEKWGYNYKGSLNDQIAKSVSGAMGEVALAKFLGIKFEYHCNVGGIPDLIYKDLKVQCRTQLPKNNNSLIIRPKANCGELYALVIDEAPIFKILGFVNSTHVLGTEKFLTNFGLDRPACHSVPPEKLTPIFLLKNGTWN |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |