NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211471_1024858

Scaffold Ga0211471_1024858


Overview

Basic Information
Taxon OID3300020287 Open in IMG/M
Scaffold IDGa0211471_1024858 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_A100001403 (ERX556018-ERR598969)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)785
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Nilusvirus → Nilusvirus ssm2(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_031
CoordinatesLat. (o)34.835Long. (o)34.8033Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023367Metagenome / Metatranscriptome210N
F029472Metagenome / Metatranscriptome188N

Sequences

Protein IDFamilyRBSSequence
Ga0211471_10248581F029472N/AMQMLSRKTIENLTDKLMVEVANYVTEDPRFTELLNELVPEAIDLELGQVDDYSVVQIITSIQQHLRCSPNHSQIHYPRCPL
Ga0211471_10248582F023367GGAGGMVMEESKDTKMKKFIFEEKFISYADVEIYAKNEEDARRQFQNGNYQYYDVSDFTDGHELINVREETE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.