| Basic Information | |
|---|---|
| Taxon OID | 3300020248 Open in IMG/M |
| Scaffold ID | Ga0211584_1000431 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100000123 (ERX556118-ERR599141) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | CEA Genoscope |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 5956 |
| Total Scaffold Genes | 15 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (13.33%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | TARA_042 | |||||||
| Coordinates | Lat. (o) | 6.0124 | Long. (o) | 73.8985 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F041143 | Metagenome / Metatranscriptome | 160 | N |
| F084357 | Metagenome | 112 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0211584_10004311 | F041143 | GGAG | MSNPRIDGIDWRSLQKGDVIPEEHILDYWNTCYPDREWDKFSMVTVRGNIEKLREGINRPIVLKEVKGSLVVLTDKEAVDYSAAQANAGIKKHRRHTRRLFTHIDSSKLDQAKKRDLETKQIHHAFIASAADGARKESLQLQRKGERLPKSLIEKSDFKKSS |
| Ga0211584_100043110 | F084357 | N/A | MNQMKFLSKPKDEYLVKDPNLNIHFKIINGVRYWLTPPPSDYKK |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |