NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211729_10652448

Scaffold Ga0211729_10652448


Overview

Basic Information
Taxon OID3300020172 Open in IMG/M
Scaffold IDGa0211729_10652448 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSciLifeLab
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3057
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Lake Microbial Communities From Lake Erken, Sweden

Source Dataset Sampling Location
Location NameLake Erken, Sweden
CoordinatesLat. (o)59.83763399Long. (o)18.6203826Alt. (m)Depth (m)0 to 20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010746Metagenome / Metatranscriptome299Y
F016115Metagenome / Metatranscriptome249Y
F035200Metagenome / Metatranscriptome172Y

Sequences

Protein IDFamilyRBSSequence
Ga0211729_106524484F016115AGGAMVGRDGDVAIYKKQLDEPDSEAYNYEVIAIKRHNGYEIAGVKMPPAEMYPSDSQWGDWGFTCTSREDADKRFIQLQEKLSAYVATATLPNGEKRGRGRPRKIDLTKTELVVS
Ga0211729_106524485F010746N/AMTYKCAVSGEAIPPERVEALQVLGVPESQWTKKEYSQTKKLRAVYAGDDGSNDIVICDAVDGGSLFDNEIVAEVEE
Ga0211729_106524486F035200GGAGGMNLRYIVLRDGYRVSEDMHTDLKEAEAEAEFWRSVIRRWPDGTKVIIKKIGGDKA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.