Basic Information | |
---|---|
Taxon OID | 3300020171 Open in IMG/M |
Scaffold ID | Ga0180732_1196479 Open in IMG/M |
Source Dataset Name | Groundwater microbial communities from the Olkiluoto Island deep subsurface site, Finland - KR11_0.1 MetaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 602 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater → Groundwater Microbial Communities From Three Deep Subsurface Sites In Europe |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Finland: Olkiluoto Island | |||||||
Coordinates | Lat. (o) | 61.2413 | Long. (o) | 21.4947 | Alt. (m) | Depth (m) | 420 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F081500 | Metagenome | 114 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0180732_11964791 | F081500 | AGGAGG | MGPRRKASEAPYGRGVPGSERVLDNEEKEQEGLIRALTSTVHHFFGGFF |
⦗Top⦘ |