| Basic Information | |
|---|---|
| Taxon OID | 3300020159 Open in IMG/M |
| Scaffold ID | Ga0211734_10724393 Open in IMG/M |
| Source Dataset Name | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | SciLifeLab |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 34451 |
| Total Scaffold Genes | 59 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 50 (84.75%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Lake Microbial Communities From Lake Erken, Sweden |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Lake Erken, Sweden | |||||||
| Coordinates | Lat. (o) | 59.83763399 | Long. (o) | 18.6203826 | Alt. (m) | Depth (m) | 0 to 12 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006696 | Metagenome | 366 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0211734_107243932 | F006696 | GGA | MQFFKFLKNYYRELTPIEVIQRELAQAHLDRLEAESACEYAKACHDLSLAQIERLKTRLGEYK |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |