Basic Information | |
---|---|
Taxon OID | 3300020137 Open in IMG/M |
Scaffold ID | Ga0206107_1064037 Open in IMG/M |
Source Dataset Name | Enriched microbial communities from leaf-cutter ant dump, University of Wisconsin, Madison, United States - 2B0 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 536 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Arthropoda → Ant Dump → Unclassified → Unclassified → Ant Dump → Characterization Of Biomass-Degrading Enzymes From Insect-Associated, Soil, And Chicken Feces Microbial Communities |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Wisconsin | |||||||
Coordinates | Lat. (o) | 43.0758 | Long. (o) | -89.4125 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F074177 | Metagenome | 120 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0206107_10640372 | F074177 | N/A | YQKSYFMKNHANQKKSALSVFFAHLAKNFAALFESGNKREFQRLKDFITS |
⦗Top⦘ |