Basic Information | |
---|---|
Taxon OID | 3300019938 Open in IMG/M |
Scaffold ID | Ga0194032_1020017 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW8Nov16_MG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 708 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → environmental samples → uncultured marine virus | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Microbial Communities From Sediments And Microbial Mats In Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Delaware | |||||||
Coordinates | Lat. (o) | 38.7906 | Long. (o) | -75.1638 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F014729 | Metagenome / Metatranscriptome | 260 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0194032_10200172 | F014729 | AGTAG | MELRIDDAHGDMDAVDLYEDLREDDMLEILGLMHHPKDAVIMSYACSTKCYSVKDDMNNLYCSFGVAPIEGTNIGSAWLLGTRRLPTIKKFFLKHSKERMEELLEG |
⦗Top⦘ |