NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194032_1000107

Scaffold Ga0194032_1000107


Overview

Basic Information
Taxon OID3300019938 Open in IMG/M
Scaffold IDGa0194032_1000107 Open in IMG/M
Source Dataset NameFreshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW8Nov16_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9082
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (78.95%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location NameUSA: Delaware
CoordinatesLat. (o)38.7906Long. (o)-75.1638Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004345Metagenome / Metatranscriptome442Y
F015169Metagenome / Metatranscriptome257Y
F036682Metagenome / Metatranscriptome169N

Sequences

Protein IDFamilyRBSSequence
Ga0194032_100010715F036682AGGAMTDKVSGDGTAYVDHDYYWRPIETAPHGVKLQLLSIYGVASHGLLSPAIIEDGFWIGWTPLPKRRKEND
Ga0194032_100010718F004345GGAGGMIEQVIVGATGLGYLTVGVLQWAKGEGANGMIWIGYAFAQVGLWLNLK
Ga0194032_10001074F015169GGAGGMEDKQYYHFKKSSSRPSVSSSTEHFYVCPDDAMWHDVMRQFAAFLDTCGYVGVYENVDIMLDDYWNRKSSREVFSE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.