NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0197830_106168

Scaffold Ga0197830_106168


Overview

Basic Information
Taxon OID3300019824 Open in IMG/M
Scaffold IDGa0197830_106168 Open in IMG/M
Source Dataset NameMicrobial mat bacterial communities from Rhone River delta, Camargue, France - 3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Barcelona
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)523
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Microbial Mats → Microbial Mat Bacterial Communities From Rhone River Delta, Camargue, France

Source Dataset Sampling Location
Location NameRhone delta, Camargue, France, EU
CoordinatesLat. (o)43.6Long. (o)4.6Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013645Metagenome / Metatranscriptome269Y

Sequences

Protein IDFamilyRBSSequence
Ga0197830_1061681F013645N/AMNPEFLFGTAFNIAYWHKKYHSGTICKGVSNPHASNALSGCEKEENPKCICRRYR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.