| Basic Information | |
|---|---|
| Taxon OID | 3300019784 Open in IMG/M |
| Scaffold ID | Ga0181359_1003468 Open in IMG/M |
| Source Dataset Name | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4836 |
| Total Scaffold Genes | 10 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → Methanosarcinaceae → Methanosarcina → unclassified Methanosarcina → Methanosarcina sp. DH1 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Michigan | |||||||
| Coordinates | Lat. (o) | 43.1881 | Long. (o) | -86.344 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007164 | Metagenome / Metatranscriptome | 356 | Y |
| F014488 | Metagenome | 262 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0181359_10034682 | F014488 | AGTAG | MNHHQGQDPADSILASYTPNMADHIDTLEDRVKERLAQMKAMNPAIDLDQLAKLTAEVVEQTIKHEGDSQMLRHRRDDTLDEALLALASNRSPDSLTAIAKRYINPSTGKPYTRAAISARLTELSQRTGLVLRIQRSERVRQIYKERALRVHKKRREQCPKWNKEAWAKGLRKRKCK |
| Ga0181359_10034684 | F007164 | GAG | MSEKQIGIELKKQIKLLNEAKDRAISSMGETISLAADAGQILLSAREENLNIVQILLISGVNEEEGRRLERVAKARPLLSAPNPSQLKQLALWSGILPDPIETSNPKAETAWHSYIIKARQWLTRKSPGSWSDDQKRQFIEEARPIVEAFREAGGEF |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |