NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0190267_10688859

Scaffold Ga0190267_10688859


Overview

Basic Information
Taxon OID3300019767 Open in IMG/M
Scaffold IDGa0190267_10688859 Open in IMG/M
Source Dataset NamePopulus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)655
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States

Source Dataset Sampling Location
Location NameUSA: Arizona
CoordinatesLat. (o)35.0244Long. (o)-111.7363Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F101835Metagenome102Y

Sequences

Protein IDFamilyRBSSequence
Ga0190267_106888592F101835N/AGEAMSCRFESDVLQAEGQWSDALRRHLLECDDCVAAAAVAPWMTRFAKISDREHPLPDPQIVWLKAQLLQGVADAARVARPMTVLQMVSYLVVAGGWAALMTWKWDAVATWLRGFTPTGIVQNVARGGSLSMSFFAFVFVLASMTVMLALHTIMAEE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.