| Basic Information | |
|---|---|
| Taxon OID | 3300019487 Open in IMG/M |
| Scaffold ID | Ga0187893_10151513 Open in IMG/M |
| Source Dataset Name | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1886 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiodictyon → Candidatus Thiodictyon syntrophicum | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: the Island of Hawaii | |||||||
| Coordinates | Lat. (o) | 19.0643 | Long. (o) | -155.8008 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021803 | Metagenome / Metatranscriptome | 217 | Y |
| F055607 | Metagenome / Metatranscriptome | 138 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0187893_101515132 | F021803 | AGGAG | MPSMEIIDELDRCKTALQVVAEMQTDGLATLLDILLDNLDNAIGQVQAQLQQCTCQARSRDPDTPVPLRRGTLTVYQRPRPVPSES |
| Ga0187893_101515133 | F055607 | AGGAGG | MRDRRYLLLTLLLGTLTLAGCARPSKPIDTRQPALIHALIHPGMAEAEVVERLGPPVLITEQPSTRVQVPTPTGLEFRDKRRYTYYYLGPSEDLDTVITLEDGVVINTRQGPR |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |