NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0190264_10036319

Scaffold Ga0190264_10036319


Overview

Basic Information
Taxon OID3300019377 Open in IMG/M
Scaffold IDGa0190264_10036319 Open in IMG/M
Source Dataset NamePopulus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1849
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States

Source Dataset Sampling Location
Location NameUSA: Utah
CoordinatesLat. (o)38.0262Long. (o)-109.5407Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001183Metagenome / Metatranscriptome755Y
F001245Metagenome / Metatranscriptome737Y
F008864Metagenome326Y

Sequences

Protein IDFamilyRBSSequence
Ga0190264_100363191F008864AGGMPLPRKKDDGGSGAPVLDIMKAHGRLIDVEEYVKPYAVTRKSDGAEFMLDPGFNCTVEIVADNDEGIDNGAKFFEKFKYKKDSEGHWINNSNSKLGTLTEVVKPGYFEDDTIPELTAEDLEGFEMICRIKPKKNPTTGQVTGSTIDWEIMKPLPKRKTA
Ga0190264_100363192F001183GAGLSEEEQRQRVRELVRKQTGVDWPELKIIDIENAMGSVTVFYWCMKKDVGKRGREKQLELTDEEAESIGVNRSVRRPNRDMNQ
Ga0190264_100363193F001245GAGGVAEVVRRVSDKALRMLKHMRKQILRQPAPYVVVRGAAISIGVDPGGSECDGLVNELLRDGHLQRYPSPSLTAHGLYRLTDLGISAADEG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.