NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0173482_10004392

Scaffold Ga0173482_10004392


Overview

Basic Information
Taxon OID3300019361 Open in IMG/M
Scaffold IDGa0173482_10004392 Open in IMG/M
Source Dataset NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3235
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.3Long. (o)-89.38Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F075799Metagenome / Metatranscriptome118N

Sequences

Protein IDFamilyRBSSequence
Ga0173482_100043923F075799GGAGGVPWSWPELVAVREAIELTPEFTGREEVRAALAARSPATQHRDVTLDVELAERLAANLLALDLQTVVAKSKLLRALREA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.