NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0184645_1133644

Scaffold Ga0184645_1133644


Overview

Basic Information
Taxon OID3300019233 Open in IMG/M
Scaffold IDGa0184645_1133644 Open in IMG/M
Source Dataset NameMetatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)640
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9195Long. (o)-106.9496Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000587Metagenome / Metatranscriptome1007Y
F002340Metagenome / Metatranscriptome569Y

Sequences

Protein IDFamilyRBSSequence
Ga0184645_11336441F000587N/ATRRTAMKTIVSALIALSVLAGIAAPASAFDAKTFYEQQDRAHD
Ga0184645_11336442F000587AGGAGMKIIVSTLVALSVLTGIAASASASDAKSFYEQQERNKN
Ga0184645_11336443F000587AGGAGMKTIVSALIALSVIAGIAAPASALDAKTFWSQQESSHN
Ga0184645_11336444F002340AGGAGMKTIVSALIALSVIAGIAAPASASVDAKAFYEKLDRSVN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.