Basic Information | |
---|---|
Taxon OID | 3300019217 Open in IMG/M |
Scaffold ID | Ga0179946_1133844 Open in IMG/M |
Source Dataset Name | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNNA4_MetaT (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 537 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Japan: Niigata Prefecture | |||||||
Coordinates | Lat. (o) | 37.43 | Long. (o) | 138.83 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F043669 | Metagenome / Metatranscriptome | 156 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0179946_11338442 | F043669 | N/A | MDKLALQSLISKMSIATDEEYHLTKSDKLAILSAFHKCKKWLIALQNEGVINISEQELEYLSDLADNVEGDINGKWSLDKPEYLAIIITLQDYLNDI |
⦗Top⦘ |