NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0180036_1011648

Scaffold Ga0180036_1011648


Overview

Basic Information
Taxon OID3300019200 Open in IMG/M
Scaffold IDGa0180036_1011648 Open in IMG/M
Source Dataset NameEstuarine microbial communities from the Columbia River estuary - R.1175 metaT (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)931
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)46.235Long. (o)-123.91Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F049561Metagenome / Metatranscriptome146N
F096905Metagenome / Metatranscriptome104N
F098924Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0180036_10116481F049561AGGAGGMTKIKVELEETDLFNAIEKIIDHPNRVEIAKVLTSIIAPHEKVSSIFFKTYFGGAAPQVLPEGTMITVNPNRLSYKTNVDGMKRIGLLNISGHATAIIKEFRGFHESHNYYVNFMNVDDNDKSYEDTGFINYQDVVSIIEEL
Ga0180036_10116482F096905N/AMESKIFTSVIGFDFKLDLVDNAGEPIRTGATRVECLSSETPNVGTKIGGESWFTNFNEPLLNKIRDYRRRND
Ga0180036_10116483F098924N/AFEVLIIGEDKSDFQEMLGITDKRKEELMRLAFKTYEQEDLFSTSCKIAVAECTHINEVVFMMSLLCKIKELKSNPLSALLSKFSDGE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.