Basic Information | |
---|---|
Taxon OID | 3300018747 Open in IMG/M |
Scaffold ID | Ga0193147_1018479 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000696 (ERX1782435-ERR1712076) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Canada's Michael Smith Genome Sciences Centre |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1135 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mediterranean Sea: TARA_022 | |||||||
Coordinates | Lat. (o) | 39.5705 | Long. (o) | 17.4101 | Alt. (m) | Depth (m) | 30 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F054552 | Metatranscriptome | 139 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0193147_10184791 | F054552 | N/A | MKAFTATLLFVVGSTVAQAPPPQYTEEQVDQNPWTGQPGTIRYTKTCEASQGSPRGKRQAQEPKEPNCYYHADDNITPAGCNGFCKDGNDGKDAHRRCRDLNGTSTQYTCTKKPVFVPLGKYDICDRFPDNFRGDGKKGPWFNTVGSNYGCSSATCCLWFPPIKCADVPLVKYAFLPFEHNGIQHSDCSDQEAAEANSITAAEIFLGSNGQQRDVCIFTAELDENQEPIKGDDGNPIVLFKKVTVEFSQCEPAHSPAAGCCQFQPIFK |
⦗Top⦘ |