NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0188826_122048

Scaffold Ga0188826_122048


Overview

Basic Information
Taxon OID3300018565 Open in IMG/M
Scaffold IDGa0188826_122048 Open in IMG/M
Source Dataset NameMetatranscriptome of marine microbial communities from Baltic Sea - GS669_3p0_dT
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)504
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Source Dataset Sampling Location
Location NameBaltic Sea
CoordinatesLat. (o)65.73045Long. (o)22.445047Alt. (m)Depth (m).3
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036560Metagenome / Metatranscriptome169N

Sequences

Protein IDFamilyRBSSequence
Ga0188826_1220481F036560N/ARVSGTTREMLQKLYGSTAAALYTQAADFNKTARFYYMKAEDTYYKANDAASYDDWKRARHQWDYFYHRR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.