NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0184635_10073036

Scaffold Ga0184635_10073036


Overview

Basic Information
Taxon OID3300018072 Open in IMG/M
Scaffold IDGa0184635_10073036 Open in IMG/M
Source Dataset NameGroundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1341
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9195Long. (o)-106.9496Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001789Metagenome / Metatranscriptome633Y
F017809Metagenome / Metatranscriptome238Y
F027582Metagenome / Metatranscriptome194Y

Sequences

Protein IDFamilyRBSSequence
Ga0184635_100730362F001789N/AMSVGWNIRVTTFDSEGRPRIVRNFLAYESDEKRAIELVRKRVPVNEGELAEAVAKVAENQFVGPGMRPGDVRRLGKKADLDEGQ
Ga0184635_100730364F027582AGCAGGMPHKFKIGTVVSYRPKDRMLSTARGTYTITGLMPAIEDKPPEYRIKHFSEEFERVAFENERIAGESEHGQR
Ga0184635_100730365F017809GAGMASDDDDPRAPYKVYEGNELKGTYATRAEARRAQQRLAESEPQCNFIIRDVLERVVI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.