Basic Information | |
---|---|
Taxon OID | 3300018062 Open in IMG/M |
Scaffold ID | Ga0187784_10156326 Open in IMG/M |
Source Dataset Name | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1862 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland → Tropical Peatland Microbial Communities From Different Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Colombia: Department of Meta | |||||||
Coordinates | Lat. (o) | 4.0627 | Long. (o) | -73.195 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F061686 | Metagenome | 131 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0187784_101563262 | F061686 | N/A | MRAPRAYVRWMSEHIGFNPRAQQNSNALSDFVVNDLMMSCPAIGSAIKSEALLPKKNSEVKSVSAVRTVDLVIFEKAKLPLVSVCVSVENKTIMAAHVKARKNRYGDIIAYSNHMHNHRKDCIAAAIIVVNVSPRYENPNGFAKGLKRPEFDMEKVVKDTIEIFSRIPLRNEPNDPSDQPEALAVMVVDYDGASS |
⦗Top⦘ |