NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0184621_10163434

Scaffold Ga0184621_10163434


Overview

Basic Information
Taxon OID3300018054 Open in IMG/M
Scaffold IDGa0184621_10163434 Open in IMG/M
Source Dataset NameGroundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)801
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9195Long. (o)-106.9496Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000280Metagenome / Metatranscriptome1383Y
F001935Metagenome / Metatranscriptome615Y
F101096Metagenome / Metatranscriptome102Y

Sequences

Protein IDFamilyRBSSequence
Ga0184621_101634341F001935N/AMFTQRLSSLEFFTYAAFFAVVVGSISAILPGRKAPLRTEPYSDDELKAHDRCLPKYFLTGGAFLLLGGVHMVLKNLPWTADWLARAGYAGHLVRDLSNTHVMIVGGGTLISTGLCWY
Ga0184621_101634342F000280AGAAGGMAQNQDDHPRPARPLVGYRDVGEDIRHGRGAIQRAWIVLAILIVIYLAWTLTVYFIEPGL
Ga0184621_101634343F101096N/ADGEWPAIYASLQALKAHVQEYPGCQGFDVFVRAEGDGDVLVNCYTTWDTAGQLEVFLERGYTFERLLADIESGLGPVRSLVMEKVF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.