| Basic Information | |
|---|---|
| Taxon OID | 3300018043 Open in IMG/M |
| Scaffold ID | Ga0187887_10257170 Open in IMG/M |
| Source Dataset Name | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1034 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus basilensis | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Minnesota | |||||||
| Coordinates | Lat. (o) | 47.5028 | Long. (o) | -93.4828 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F041558 | Metagenome | 159 | N |
| F042700 | Metagenome | 157 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0187887_102571701 | F041558 | AGGAG | MPLRKNQPKQVKAKAKPAPLKPTTKTEPAAAPAVVAPQAPKFTAGDLVRKALQLRQQHTLNAPAATGEALGAPKGPKPTIVEFKVTLSDGTVLHATGKHADVMVRFSNECQEICQTQGLAAYNGPPLTHYTAEEWAAKNA |
| Ga0187887_102571702 | F042700 | N/A | MDAQKEAYKLLKEHGEQIRHNKHEAWRVNGHLITITKTRTDDRGWLNKLCEIRRCLKMPAEESFRQARCNGKGRFTDAPVAQHSVSCAGPAAAR |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |