NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187871_10137894

Scaffold Ga0187871_10137894


Overview

Basic Information
Taxon OID3300018042 Open in IMG/M
Scaffold IDGa0187871_10137894 Open in IMG/M
Source Dataset NamePeatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1384
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000323Metagenome / Metatranscriptome1300Y
F003754Metagenome / Metatranscriptome470Y

Sequences

Protein IDFamilyRBSSequence
Ga0187871_101378942F000323AGGMRNVWFAVLLLSGAFLLAQDNNSANNAQQDSKNSKGEVTIRGCVSRSNGDYILMKENPAVSYQLQGSHKVKLRHYLGQRVEVTGSESPTMSTSSDAMNKVGSAAPVTININSIKVLDKDCSARDVSR
Ga0187871_101378943F003754N/ARKEKGKQYLYVQQASKQGYMIVDVSKPEMPALLQRTVGSTSENLEMVSPNIAIAEAPDKNPATLTSSSHPTETVRVLDLSDPRNPKTLETFNKVTSILPDGGHGLIYLTNNDGLYILRYEHPSRFEPAKKKPPCDSEAEIQAMPPDCQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.