NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181600_10005335

Scaffold Ga0181600_10005335


Overview

Basic Information
Taxon OID3300018036 Open in IMG/M
Scaffold IDGa0181600_10005335 Open in IMG/M
Source Dataset NameCoastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9682
Total Scaffold Genes19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (42.11%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017634Metagenome / Metatranscriptome239Y
F020163Metagenome / Metatranscriptome225N
F031081Metagenome / Metatranscriptome183N
F078659Metagenome / Metatranscriptome116N

Sequences

Protein IDFamilyRBSSequence
Ga0181600_1000533510F020163AGGAMITILLIIGFSILFILGRRSAYTKPASSDLWKPIEDLLPNLSRFRNLDSVTYEKFMENLNLSKKEMINPDITIIRGSNLERSGMYLRRAVDDFSSLSISLPSGDSVYHDEIAELAANLAITGEKVLMEAATETKKTFTPRLLNALID
Ga0181600_1000533516F031081GGAMVKVERSSYPVKKFMVKSPKGQTIYFGQAGYGDYDLWARVDPEYAERKRYRYTTSHKAIPLKDGTPAWKSPETAEYYAMRGTWDEPRGNPLFKQVVAMRNMSLTKEEKAFITKQKRLRLKSA
Ga0181600_1000533517F078659N/AMWYEPETEYDIRLVNMDQLMMTPAILRAVKRAGVRLKEKNFEMDPYPAPTPLKEDITKLDFFEGTPVKVKEHGDFYSIIDGRHRVAAMLCKKFKQISVEVVSV
Ga0181600_100053357F017634AGTAGMDSFNTIASIAFGMIAAWVVFEKSETYIPLQTDTGDDPSKYYASPMEVMDETLYVTNPESLYAGFSLEPGKQVQKIPIGPVVDRLGNVQEIPGLPDRDILYPIKEDVNLVIEKIPVPGSGSGDIEVFPQF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.