| Basic Information | |
|---|---|
| Taxon OID | 3300018031 Open in IMG/M |
| Scaffold ID | Ga0184634_10008488 Open in IMG/M |
| Source Dataset Name | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3575 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: East River, Colorado | |||||||
| Coordinates | Lat. (o) | 38.9195 | Long. (o) | -106.9496 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F006963 | Metagenome / Metatranscriptome | 361 | Y |
| F093814 | Metagenome / Metatranscriptome | 106 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0184634_100084885 | F006963 | N/A | MFFRHRRQAEVTIRHATKRALCAALLSALGATQASTQTPVSQRLLELDDDERNTSFTLMLMDSGRRCDEVVRTLFKGTVLGVDEWEALCKDRNAYSISVLTEQDETIITSLSCRELSATSKMLLHRSGSRSKAAGCRIK |
| Ga0184634_100084888 | F093814 | N/A | AATTEWGSVVEKLSIRLKQQAVAARAEALARTVEKLRSLHTGLPVRMAESDFDRVWYGHCPVKAGLKPVALGPEPLKDDGAA |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |