NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187815_10035519

Scaffold Ga0187815_10035519


Overview

Basic Information
Taxon OID3300018001 Open in IMG/M
Scaffold IDGa0187815_10035519 Open in IMG/M
Source Dataset NameWetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2110
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment → Coastal Wetland Sediment Microbial Communities From The Mid-Atlantic And Southeast Atlantic Coast Of Usa, Responding To Salinity Intrusion.

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)35.9061Long. (o)-76.1569Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001173Metagenome / Metatranscriptome757Y
F003545Metagenome / Metatranscriptome480Y

Sequences

Protein IDFamilyRBSSequence
Ga0187815_100355194F003545GGAGGMTAFAITGMGLTGVLRTTWVHDNLAHVLRHSRTDEPSGTWTGLACPGHGLALGTDVDNAALQRLAAGSEIADLIWEAPDELTAEHGQVFQAAIRAYHAADSERAEELWDKVRAVWSRAWSANYAVLEFMQGTGLTRFSPVKPQQWVVASFEHHCSPHGLPRPHIHNIVITSLTTAANVR
Ga0187815_100355195F001173N/AAGHRTFAGTLAERQSLTVPAEDPDYGDLGQAFPPWPGPATDAILQPPKPEIRPCRQVLQRAAGRDADPEAAD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.