NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0184610_1009008

Scaffold Ga0184610_1009008


Overview

Basic Information
Taxon OID3300017997 Open in IMG/M
Scaffold IDGa0184610_1009008 Open in IMG/M
Source Dataset NameGroundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2458
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9195Long. (o)-106.9496Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013143Metagenome / Metatranscriptome274Y
F051769Metagenome / Metatranscriptome143Y
F095084Metagenome / Metatranscriptome105N

Sequences

Protein IDFamilyRBSSequence
Ga0184610_10090083F013143AGGAGMLSRFVLGAIVGGIAVYLWGDEIRRFANTKSRTARLAAADTLKAVQSTAEDMFDSAKDQVTSTLQSGQDAIRPARANRDR
Ga0184610_10090084F095084GGAGGMSGMPALYCRTCNTFREVEDWRERGEALVIALEPCGHEIRRRAGIEWPIHTVAA
Ga0184610_10090085F051769N/AAAVLLAMGGLGLGLFLLGGRRATPLPVVRCPIHGIAYDAELEVCPDCAKMDAVGGKGGAR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.