NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187816_10069584

Scaffold Ga0187816_10069584


Overview

Basic Information
Taxon OID3300017995 Open in IMG/M
Scaffold IDGa0187816_10069584 Open in IMG/M
Source Dataset NameWetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1490
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment → Coastal Wetland Sediment Microbial Communities From The Mid-Atlantic And Southeast Atlantic Coast Of Usa, Responding To Salinity Intrusion.

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)35.9061Long. (o)-76.1569Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014053Metagenome / Metatranscriptome266Y
F094165Metagenome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0187816_100695841F094165GAGGMPRRRIQCAMSKRKVLSDDDRRAIIAGFTREDFERLNRLAHAKNLRSIIKCTKWLNDHGVELLRRYPQEFRDGTGMTVEQYLHALTVHVDRCRIFLKKMGGLEDT
Ga0187816_100695842F014053AGGAGVHRNPVNHEHLMRESTDRVHSALYSDNPNEQLVASRLLESPSAFRTWESEHSGLMREVANPSFRRTQAALLKKATFRLIHRKALFEYLRDERIRGSVRRRIIVSFHPAQDYTRSVIAEHGLYLRKACSFLCTSHVGGNVVRDPGFFDPMRRYQELYAEYFRIFCNTHFGTDSADAEPQGELLPLLKHQLEECRIAIMNPQPETEWLMREAELRQPTGDTVRLPQLGVVKRQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.