NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187782_10122148

Scaffold Ga0187782_10122148


Overview

Basic Information
Taxon OID3300017975 Open in IMG/M
Scaffold IDGa0187782_10122148 Open in IMG/M
Source Dataset NameTropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1926
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland → Tropical Peatland Microbial Communities From Different Locations

Source Dataset Sampling Location
Location NameColombia: Department of Meta
CoordinatesLat. (o)4.0627Long. (o)-73.195Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001473Metagenome / Metatranscriptome688Y
F002408Metagenome / Metatranscriptome562Y
F005213Metagenome / Metatranscriptome408N
F025071Metagenome / Metatranscriptome203N

Sequences

Protein IDFamilyRBSSequence
Ga0187782_101221481F002408N/AAAAAKADLGVLIRDIYRRQDEVFVRFSIENRSSQTLRAGPPAVVSLTGLKFDRSLWAFQNAQLGMEYASRLKTYDAPIPVKIRQCEPGVAEVGPGEARIGLIALQLPPVKPDAKKTQPTVLKILFPIDRTGNLTATLVL
Ga0187782_101221482F001473GGAGMESEYQTVGQMYERLRLMIRQRNDTGFRLAATDAVFEPRNPFEPANKRRPKSVVAIILALVVILALIFLYFSFHHAR
Ga0187782_101221483F005213AGGGGGMASNATKMVNETEETRSEPRPDVEFQDVLFSDLATLVCYWITIVLLAVVGAYLIRWWLIHPGCYAAPVQDPWGITTPPWLILPLPPIGVIGSLGHAAWRALRGQRTWKMLMTSASLIAVMGCSKLLETYLAPM
Ga0187782_101221484F025071GAGGMIHNSEPPRREMTNGEAGVVGAVLGFGLIALLLYLAVARYHIRKEQLVEVGLYLFVIAAAVIAPVLRKFTTRGKRTKRPPFVIPARKDERAIESAWNQNAVLLGYDMDETPWL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.