NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187847_10017761

Scaffold Ga0187847_10017761


Overview

Basic Information
Taxon OID3300017948 Open in IMG/M
Scaffold IDGa0187847_10017761 Open in IMG/M
Source Dataset NamePeatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4460
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland → Peatland Microbial Communities From Minnesota, Usa, Analyzing Carbon Cycling And Trace Gas Fluxes

Source Dataset Sampling Location
Location NameUSA: Minnesota
CoordinatesLat. (o)47.5028Long. (o)-93.4828Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008200Metagenome / Metatranscriptome337Y
F010710Metagenome / Metatranscriptome300Y

Sequences

Protein IDFamilyRBSSequence
Ga0187847_100177613F010710GGCGGMPIVIASPIAHPEHKFFNTQNRVLIIASAALNGADFAVTRANLQSGGEELNPLVRVFGRSTAGLAVNFAGETASVIGLGYFFHKTGHHKLERATFLVNIGSSAGAVTYGLTHR
Ga0187847_100177615F008200AGGMNEFGVLTNRKRALIALIHSLVFLGIAAHGFASPKVGVLVPGPAATSDFILIGIYFTVASILAWLVSIARCAKERVYFALCTSSVTFGLLRTVFGDAALPVAQYLRVIMLTSAVIVGTRIFRSFSRPIAEGAVLD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.