| Basic Information | |
|---|---|
| Taxon OID | 3300017823 Open in IMG/M |
| Scaffold ID | Ga0187818_10068550 Open in IMG/M |
| Source Dataset Name | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1527 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment → Coastal Wetland Sediment Microbial Communities From The Mid-Atlantic And Southeast Atlantic Coast Of Usa, Responding To Salinity Intrusion. |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: North Carolina | |||||||
| Coordinates | Lat. (o) | 35.9061 | Long. (o) | -76.1569 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001558 | Metagenome / Metatranscriptome | 671 | Y |
| F008980 | Metagenome / Metatranscriptome | 325 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0187818_100685501 | F008980 | AGGA | MISAANTSLPESAVHESVGGVLIQHREELEWLANFLLGDEKIAEACVVDACALAESVSPGVQDWRLKWACLTMIQSAVQMQQRRITQLAAAYKQRGCIHGGHTALSSDWRDVLVEESSALTARLDVLSRFVLVLCGLQKRSTQQAAVLLGIDRI |
| Ga0187818_100685502 | F001558 | GAGG | MLRVQTQELDGALICRLEGRFTGEGAEEVRTLVTRCDGKLELVVDLTDVMFIDAIGEEVLLFVKRLGARFVADTSYSRDICERLDLPLVRNHKSNMHVPGNSDGGQSFGN |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |