NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181348_1063383

Scaffold Ga0181348_1063383


Overview

Basic Information
Taxon OID3300017784 Open in IMG/M
Scaffold IDGa0181348_1063383 Open in IMG/M
Source Dataset NameFreshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1492
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)43.1998Long. (o)-86.5698Alt. (m)Depth (m)110
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000645Metagenome / Metatranscriptome962Y
F014016Metagenome / Metatranscriptome266N
F014613Metagenome / Metatranscriptome261Y

Sequences

Protein IDFamilyRBSSequence
Ga0181348_10633831F000645GAGMSNYLDDYVSVQDRLKEFINAYPDYRIKTHTLAESLVANCDVYIVKVELYRTEADANPWTTGLSSESKSKQYALELAETGALGRALNLAGFFAKPTGAPKKAIQTTKPELASFIKEQRPNDPEPIVWDVSDIAEKLGAEVIDELPLCKCGRGPMILKSGTKDGKEYRGYTCPSKDRADQCPARWMRIGADGHWV
Ga0181348_10633833F014613GAGMLPNLSNEAVVGIIIGVPFIGLYLWALWSSAKAKAFNEGYKRGRSSVRYTEVLK
Ga0181348_10633834F014016N/AGLEGSKMANKVALIRFDSQAGAWTDETNWVKGSIIRRFAKERMGKKQLRGRLSKAEISAYWLDKYGVSADVA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.