| Basic Information | |
|---|---|
| Taxon OID | 3300017778 Open in IMG/M |
| Scaffold ID | Ga0181349_1004302 Open in IMG/M |
| Source Dataset Name | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 6058 |
| Total Scaffold Genes | 9 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (55.56%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Michigan | |||||||
| Coordinates | Lat. (o) | 43.1998 | Long. (o) | -86.5698 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F064497 | Metagenome | 128 | N |
| F064671 | Metagenome | 128 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0181349_10043024 | F064671 | AGGA | VAVVIPNCGTYMVEMDFGSSTNQFVLDSATAGVLDSTEYFLDGTTDFQDVTEYVKQVSINRGRQNKFRDPTGQPSTAVIQIEDSDYSFSLVNTASPYWNATKNRLGFELNSGVRISRNGTYLFTGIITQYDQRIENPNRSLVTVNCSDELFGLNNSKTTFFTATPERSDTRINTVLTNAGVFSKDGQRVLETGVANLGNAPVDETASVLEYLLRINNSEQGRVWVDGSGNFHFDRRLVGELQAVEATLADTGGTAIPFTTFDIVNN |
| Ga0181349_10043029 | F064497 | N/A | TGLDFDSWINEIEALELGNQADAVIVPLEISQPIG |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |