NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181352_1004767

Scaffold Ga0181352_1004767


Overview

Basic Information
Taxon OID3300017747 Open in IMG/M
Scaffold IDGa0181352_1004767 Open in IMG/M
Source Dataset NameFreshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4638
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (40.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Freshwater Lake Microbial Communities From The Great Lakes, Usa, Analyzing Microbial Food Webs And Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: Michigan
CoordinatesLat. (o)43.2382Long. (o)-86.2805Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000332Metagenome / Metatranscriptome1283Y
F001538Metagenome / Metatranscriptome674Y
F004432Metagenome / Metatranscriptome438Y

Sequences

Protein IDFamilyRBSSequence
Ga0181352_10047675F004432GGAMVTKKPPAKVAPVKRRTPRPKPEQTINVSVAAPASKPEAKKDDSALGKVIGLIEWVDNPFKLFTVILLSFLFFAGYFAWDSRQVILHAITTQDKMPQLAKQENLLAPARSLLKDVDGIVLLIHKANLSTNSRTTVLALNVDGSREKAIEGSITSLFNASSDRNGAMVSMLNGEVLCEEFKPSSKVGEWGVKQGVKFMCRGSIPPDMGKFAGYVAIGFKDKPEDIAALKTRINLAATDMSE
Ga0181352_10047676F001538N/AMIETIRLFPTVQASGYPDKHDLAQAKLEKQHEVNKTVEQAKQKQTELQDIGFEIYCKKVVQERLRMEIFQNRKLDIYA
Ga0181352_10047677F000332N/AMRWLILLLLFGLVGAVAKNGCHVREFYGIGYTVHNPTERHFKMLEWLKNNAQYCKTTDYVVMWNNLSEWAGSADSTWLRAAIIHNYKDAKEREK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.