NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0181398_1000326

Scaffold Ga0181398_1000326


Overview

Basic Information
Taxon OID3300017725 Open in IMG/M
Scaffold IDGa0181398_1000326 Open in IMG/M
Source Dataset NameMarine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)14314
Total Scaffold Genes23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (43.48%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Marine Viral Communities From The Oligotrophic San Pedro Time Series (Spot) Site, San Pedro Channel, Ca, Usa

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)33.55Long. (o)-118.4Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001582Metagenome / Metatranscriptome668Y
F004956Metagenome / Metatranscriptome417Y
F028655Metagenome / Metatranscriptome191N

Sequences

Protein IDFamilyRBSSequence
Ga0181398_100032615F001582N/AMALESAADFNSYLDSTTGHGVTATFFEVQNSLFDQRVGFIDSWFDIDSGNRENINIIIDQEYFDIAGNSVAVEGFQPKALVKSSDVPYISHEDRLIVNAITTNKGTVLKAETTFVIKNVQPDNTGFIELILEEQ
Ga0181398_100032618F004956GAGGMKLFSPDGKISIDAHPSRVESLLNKGWKEEATKEIKSSSKKEVKENGST
Ga0181398_100032620F028655N/AMKVIDKAKAHFNSLDIKEIEIPEWSDDGEILKVYAKPLTLAEMSKLQKYAKDDDVALMAYCLIHKALDAEGNKVFDIGDKTTLMNGVDKDVLARVATEIMSAPSVEEQLKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.